USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
0 items
New Products
Product Details
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Two Color Deluxe Senior Sash With Name
Brand:Bowerella Bows
Product Code:TWOCOLORDELUXESENIORSASHNAME
weight:10.0oz
Product Condition:New
$19.04 inc. tax
$18.00 ex. tax
? Tax based on California, United States.
Add to Cart
Description
Sashes are a must have for Homecoming and Senior Night! Choose your colors and upload your mascot or logo to create the perfect sashes for your seniors! Sashes are 33" long and 4" wide. You'll be prompted to upload your logo or mascot after you add the sash to your cart.
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i